Lineage for d1jibb1 (1jib B:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54646Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 54647Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (4 PDB entries)
  8. 54655Domain d1jibb1: 1jib B:1-120 [63072]
    Other proteins in same PDB: d1jiba2, d1jiba3, d1jibb2, d1jibb3

Details for d1jibb1

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

SCOP Domain Sequences for d1jibb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jibb1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1jibb1:

Click to download the PDB-style file with coordinates for d1jibb1.
(The format of our PDB-style files is described here.)

Timeline for d1jibb1: