Lineage for d1jiba3 (1jib A:121-502)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64842Protein Maltogenic amylase, central domain [51465] (2 species)
  7. 64843Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (4 PDB entries)
  8. 64850Domain d1jiba3: 1jib A:121-502 [63071]
    Other proteins in same PDB: d1jiba1, d1jiba2, d1jibb1, d1jibb2

Details for d1jiba3

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

SCOP Domain Sequences for d1jiba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiba3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1jiba3:

Click to download the PDB-style file with coordinates for d1jiba3.
(The format of our PDB-style files is described here.)

Timeline for d1jiba3: