Lineage for d1jiba2 (1jib A:503-585)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328173Protein Maltogenic amylase [51031] (4 species)
  7. 1328188Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)
  8. 1328219Domain d1jiba2: 1jib A:503-585 [63070]
    Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3
    complexed with mtt

Details for d1jiba2

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.
PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1jiba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiba2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1jiba2:

Click to download the PDB-style file with coordinates for d1jiba2.
(The format of our PDB-style files is described here.)

Timeline for d1jiba2: