Lineage for d1jiba2 (1jib A:503-585)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63123Protein Maltogenic amylase [51031] (2 species)
  7. 63124Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (4 PDB entries)
  8. 63131Domain d1jiba2: 1jib A:503-585 [63070]
    Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3

Details for d1jiba2

PDB Entry: 1jib (more details), 3.3 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with maltotetraose based on a crystal soaked with maltohexaose.

SCOP Domain Sequences for d1jiba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiba2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1jiba2:

Click to download the PDB-style file with coordinates for d1jiba2.
(The format of our PDB-style files is described here.)

Timeline for d1jiba2: