Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries) |
Domain d1jiba2: 1jib A:503-585 [63070] Other proteins in same PDB: d1jiba1, d1jiba3, d1jibb1, d1jibb3 |
PDB Entry: 1jib (more details), 3.3 Å
SCOPe Domain Sequences for d1jiba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jiba2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1jiba2: