Lineage for d1ji6a3 (1ji6 A:64-290)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955230Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 1955231Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 1955232Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species)
  7. 1955237Species Bacillus thuringiensis, CRY3bb1 [TaxId:1428] [64522] (1 PDB entry)
  8. 1955238Domain d1ji6a3: 1ji6 A:64-290 [63068]
    Other proteins in same PDB: d1ji6a1, d1ji6a2

Details for d1ji6a3

PDB Entry: 1ji6 (more details), 2.4 Å

PDB Description: crystal structure of the insecticidal bacterial del endotoxin cry3bb1 bacillus thuringiensis
PDB Compounds: (A:) pesticidial crystal protein cry3bb

SCOPe Domain Sequences for d1ji6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji6a3 f.1.3.1 (A:64-290) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRY3bb1 [TaxId: 1428]}
davgtgisvvgqilgvvgvpfagaltsfyqsflntiwpsdadpwkafmaqvevlidkkie
eyakskalaelqglqnnfedyvnalnswkktplslrskrsqdrirelfsqaeshfrnsmp
sfavskfevlflptyaqaanthllllkdaqvfgeewgyssedvaefyhrqlkltqqytdh
cvnwynvglnglrgstydawvkfnrfrremtltvldlivlfpfydir

SCOPe Domain Coordinates for d1ji6a3:

Click to download the PDB-style file with coordinates for d1ji6a3.
(The format of our PDB-style files is described here.)

Timeline for d1ji6a3: