Lineage for d1ji6a2 (1ji6 A:291-502)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566741Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 566748Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (1 family) (S)
  5. 566749Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein)
  6. 566750Protein delta-Endotoxin (insectocide), middle domain [51098] (4 species)
  7. 566755Species Bacillus thuringiensis, CRY3bb1 [TaxId:1428] [63845] (1 PDB entry)
  8. 566756Domain d1ji6a2: 1ji6 A:291-502 [63067]
    Other proteins in same PDB: d1ji6a1, d1ji6a3

Details for d1ji6a2

PDB Entry: 1ji6 (more details), 2.4 Å

PDB Description: crystal structure of the insecticidal bacterial del endotoxin cry3bb1 bacillus thuringiensis

SCOP Domain Sequences for d1ji6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji6a2 b.77.2.1 (A:291-502) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis, CRY3bb1}
lyskgvkteltrdiftdpifslntlqeygptflsiensirkphlfdylqgiefhtrlqpg
yfgkdsfnywsgnyvetrpsigssktitspfygdkstepvqklsfdgqkvyrtiantdva
awpngkvylgvtkvdfsqyddqknetstqtydskrnnghvsaqdsidqlppettdeplek
ayshqlnyaecflmqdrrgtipfftwthrsvd

SCOP Domain Coordinates for d1ji6a2:

Click to download the PDB-style file with coordinates for d1ji6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ji6a2: