SCOP 1.61: Domain d1jhta1: 1jht A:182-275

Lineage for d1jhta1 (1jht A:182-275)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)

8. Domain d1jhta1: 1jht A:182-275 [63063]
   Other proteins in same PDB: d1jhta2

Details for d1jhta1

PDB Entry: 1jht, 2.15 Å

PDB Description: crystal structure of hla-a2*0201 in complex with a nonameric altered peptide ligand (algigiltv) from the mart-1/melan-a.

SCOP Domain Sequences for d1jhta1:

Sequence, based on SEQRES records:

>d1jhta1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1jhta1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqttelvetrpagdgtfqk
waavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1jhta1:

• d1jhta1 first appeared in SCOP 1.57
  
• d1jhta1 appears in SCOP 1.59
  
• d1jhta1 appears in SCOP 1.63
  
• d1jhta1 appears in the current release, SCOPe 2.08