Lineage for d1jhfb1 (1jhf B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172331Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
  4. 172332Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) (S)
  5. 172333Family b.87.1.1: LexA-related [51307] (3 proteins)
  6. 172346Protein LexA C-terminal domain [63871] (1 species)
  7. 172347Species Escherichia coli [TaxId:562] [63872] (4 PDB entries)
  8. 172349Domain d1jhfb1: 1jhf B: [63059]
    Other proteins in same PDB: d1jhfa1

Details for d1jhfb1

PDB Entry: 1jhf (more details), 1.8 Å

PDB Description: lexa g85d mutant

SCOP Domain Sequences for d1jhfb1:

Sequence, based on SEQRES records: (download)

>d1jhfb1 b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli}
glplvgrvaadepllaqqhieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavh
ktqdvrngqvvvariddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavg
virng

Sequence, based on observed residues (ATOM records): (download)

>d1jhfb1 b.87.1.1 (B:) LexA C-terminal domain {Escherichia coli}
glplvieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavhktqdvrngqvvvar
iddevtvkrlkkqgnkvellpensefkpivvdlrqqsftieglavgvirng

SCOP Domain Coordinates for d1jhfb1:

Click to download the PDB-style file with coordinates for d1jhfb1.
(The format of our PDB-style files is described here.)

Timeline for d1jhfb1: