SCOP 1.63: Domain d1jhfa1: 1jhf A:2-72

Lineage for d1jhfa1 (1jhf A:2-72)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.2: LexA repressor, N-terminal DNA-binding domain [46789] (1 protein)

6. Protein LexA repressor, N-terminal DNA-binding domain [46790] (1 species)

7. Species Escherichia coli [TaxId:562] [46791] (4 PDB entries)

8. Domain d1jhfa1: 1jhf A:2-72 [63057]
   Other proteins in same PDB: d1jhfa2, d1jhfb_
   complexed with so4; mutant

Details for d1jhfa1

PDB Entry: 1jhf, 1.8 Å

PDB Description: lexa g85d mutant

SCOP Domain Sequences for d1jhfa1:

Sequence; same for both SEQRES and ATOM records:

>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli}
kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
asrgirllqee

Timeline for d1jhfa1:

• d1jhfa1 first appeared in SCOP 1.57
  
• d1jhfa1 appears in SCOP 1.61
  
• d1jhfa1 appears in SCOP 1.65
  
• d1jhfa1 appears in the current release, SCOPe 2.08