Lineage for d1jh0l_ (1jh0 L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255330Protein L (light) subunit [81477] (3 species)
  7. 2255331Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
    Uniprot P02954
  8. 2255397Domain d1jh0l_: 1jh0 L: [63036]
    Other proteins in same PDB: d1jh0h1, d1jh0h2, d1jh0m_
    complexed with bcl, bph, fe, spo, u10; mutant

Details for d1jh0l_

PDB Entry: 1jh0 (more details), 3.5 Å

PDB Description: photosynthetic reaction center mutant with glu l 205 replaced to leu
PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1jh0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh0l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgklmrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipggin

SCOPe Domain Coordinates for d1jh0l_:

Click to download the PDB-style file with coordinates for d1jh0l_.
(The format of our PDB-style files is described here.)

Timeline for d1jh0l_: