SCOPe 2.05: Domain d1jgzm_: 1jgz M:

Lineage for d1jgzm_ (1jgz M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d1jgzm_: 1jgz M: [63033]
   Other proteins in same PDB: d1jgzh1, d1jgzh2, d1jgzl_
   complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgzm_

PDB Entry: 1jgz, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with lys

PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d1jgzm_:

Sequence; same for both SEQRES and ATOM records:

>d1jgzm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwkqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1jgzm_:

• d1jgzm_ first appeared in SCOP 1.57, called d1jgzm1
  
• d1jgzm_ appears in SCOPe 2.04
  
• d1jgzm_ appears in SCOPe 2.06
  
• d1jgzm_ appears in the current release, SCOPe 2.08