SCOP 1.75: Domain d1jgzl_: 1jgz L:

Lineage for d1jgzl_ (1jgz L:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
   Uniprot P02954

8. Domain d1jgzl_: 1jgz L: [63032]
   Other proteins in same PDB: d1jgzh1, d1jgzh2, d1jgzm_
   complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgzl_

PDB Entry: 1jgz, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with lys

PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOP Domain Sequences for d1jgzl_:

Sequence; same for both SEQRES and ATOM records:

>d1jgzl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1jgzl_:

• d1jgzl_ first appeared in SCOP 1.57, called d1jgzl1
  
• d1jgzl_ appears in SCOP 1.73
  
• d1jgzl_ appears in SCOPe 2.01
  
• d1jgzl_ appears in the current release, SCOPe 2.08