SCOPe 2.04: Domain d1jgzh1: 1jgz H:36-246

Lineage for d1jgzh1 (1jgz H:36-246)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d1jgzh1: 1jgz H:36-246 [63030]
   Other proteins in same PDB: d1jgzh2, d1jgzl_, d1jgzm_
   complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgzh1

PDB Entry: 1jgz, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with lys

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d1jgzh1:

Sequence; same for both SEQRES and ATOM records:

>d1jgzh1 b.41.1.1 (H:36-246) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaap

Timeline for d1jgzh1:

• d1jgzh1 first appeared in SCOP 1.57
  
• d1jgzh1 appears in SCOPe 2.03
  
• d1jgzh1 appears in SCOPe 2.05
  
• d1jgzh1 appears in the current release, SCOPe 2.08