Lineage for d1jgym_ (1jgy M:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268448Domain d1jgym_: 1jgy M: [63029]
    Other proteins in same PDB: d1jgyh1, d1jgyh2, d1jgyl_
    complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgym_

PDB Entry: 1jgy (more details), 2.7 Å

PDB Description: Photosynthetic Reaction Center Mutant With Tyr M 76 Replaced With Phe
PDB Compounds: (M:)

SCOP Domain Sequences for d1jgym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwfqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1jgym_:

Click to download the PDB-style file with coordinates for d1jgym_.
(The format of our PDB-style files is described here.)

Timeline for d1jgym_: