SCOP 1.61: Domain d1jgyh1: 1jgy H:36-250

Lineage for d1jgyh1 (1jgy H:36-250)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (28 PDB entries)

8. Domain d1jgyh1: 1jgy H:36-250 [63026]
   Other proteins in same PDB: d1jgyh2, d1jgyl1, d1jgym1

Details for d1jgyh1

PDB Entry: 1jgy, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with phe

SCOP Domain Sequences for d1jgyh1:

Sequence; same for both SEQRES and ATOM records:

>d1jgyh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1jgyh1:

• d1jgyh1 first appeared in SCOP 1.57
  
• d1jgyh1 appears in SCOP 1.59
  
• d1jgyh1 appears in SCOP 1.63
  
• d1jgyh1 appears in the current release, SCOPe 2.08