SCOP 1.63: Domain d1jgxh1: 1jgx H:36-250

Lineage for d1jgxh1 (1jgx H:36-250)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)

8. Domain d1jgxh1: 1jgx H:36-250 [63022]
   Other proteins in same PDB: d1jgxh2, d1jgxl_, d1jgxm_
   complexed with bcl, bph, fe, spo, u10; mutant

Details for d1jgxh1

PDB Entry: 1jgx, 3.01 Å

PDB Description: photosynthetic reaction center mutant with thr m 21 replaced with asp

SCOP Domain Sequences for d1jgxh1:

Sequence; same for both SEQRES and ATOM records:

>d1jgxh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1jgxh1:

• d1jgxh1 first appeared in SCOP 1.57
  
• d1jgxh1 appears in SCOP 1.61
  
• d1jgxh1 appears in SCOP 1.65
  
• d1jgxh1 appears in the current release, SCOPe 2.08