Lineage for d1jgqw_ (1jgq W:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897084Domain d1jgqw_: 1jgq W: [63016]

Details for d1jgqw_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (W:) 30S ribosomal protein S20

SCOP Domain Sequences for d1jgqw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1jgqw_:

Click to download the PDB-style file with coordinates for d1jgqw_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqw_: