Lineage for d1jgqv_ (1jgq V:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206273Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 206355Domain d1jgqv_: 1jgq V: [63015]

Details for d1jgqv_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgqv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqv_ i.1.1.1 (V:) 70S ribosome functional complex {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1jgqv_:

Click to download the PDB-style file with coordinates for d1jgqv_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqv_: