Lineage for d1jgqs_ (1jgq S:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. Protein 70S ribosome functional complex [58121] (2 species)
  7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. Domain d1jgqs_: 1jgq S: [63012]

Details for d1jgqs_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgqs_:

Sequence, based on SEQRES records: (download)

>d1jgqs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar
ywlsvgaqptdtarrllrqagvfrqe

Sequence, based on observed residues (ATOM records): (download)

>d1jgqs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1jgqs_ are not available.

Timeline for d1jgqs_: