Lineage for d1jgqp_ (1jgq P:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627637Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 627713Domain d1jgqp_: 1jgq P: [63009]

Details for d1jgqp_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgqp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqp_ i.1.1.1 (P:) 70S ribosome functional complex {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1jgqp_:

Click to download the PDB-style file with coordinates for d1jgqp_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqp_: