SCOPe 2.04: Domain d1jgqg_: 1jgq G:

Lineage for d1jgqg_ (1jgq G:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)

8. Domain d1jgqg_: 1jgq G: [63000]

Details for d1jgqg_

PDB Entry: 1jgq, 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

PDB Compounds: (G:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1jgqg_:

Sequence; same for both SEQRES and ATOM records:

>d1jgqg_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

Timeline for d1jgqg_:

• d1jgqg_ first appeared in SCOP 1.57
  
• d1jgqg_ appears in SCOPe 2.03
  
• d1jgqg_ appears in SCOPe 2.05
  
• d1jgqg_ appears in the current release, SCOPe 2.08