Lineage for d1jgpu_ (1jgp U:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. Domain d1jgpu_: 1jgp U: [62993]

Details for d1jgpu_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (U:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1jgpu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1jgpu_:

Click to download the PDB-style file with coordinates for d1jgpu_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpu_: