Lineage for d1jgps_ (1jgp S:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206273Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 206439Domain d1jgps_: 1jgp S: [62991]

Details for d1jgps_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgps_:

Sequence, based on SEQRES records: (download)

>d1jgps_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar
ywlsvgaqptdtarrllrqagvfrqe

Sequence, based on observed residues (ATOM records): (download)

>d1jgps_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1jgps_:

Click to download the PDB-style file with coordinates for d1jgps_.
(The format of our PDB-style files is described here.)

Timeline for d1jgps_: