| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
| Domain d1jgpm_: 1jgp M: [62985] |
PDB Entry: 1jgp (more details)
SCOPe Domain Sequences for d1jgpm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgpm_ i.1.1.1 (M:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1jgpm_: