Lineage for d1jgpg_ (1jgp G:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1249067Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1249250Domain d1jgpg_: 1jgp G: [62979]

Details for d1jgpg_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (G:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1jgpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpg_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOPe Domain Coordinates for d1jgpg_:

Click to download the PDB-style file with coordinates for d1jgpg_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpg_: