Lineage for d1jgou_ (1jgo U:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070170Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1070342Domain d1jgou_: 1jgo U: [62972]

Details for d1jgou_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (U:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1jgou_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgou_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1jgou_:

Click to download the PDB-style file with coordinates for d1jgou_.
(The format of our PDB-style files is described here.)

Timeline for d1jgou_: