SCOPe 2.04: Domain d1jgom_: 1jgo M:

Lineage for d1jgom_ (1jgo M:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)

8. Domain d1jgom_: 1jgo M: [62964]

Details for d1jgom_

PDB Entry: 1jgo, 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

PDB Compounds: (M:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1jgom_:

Sequence; same for both SEQRES and ATOM records:

>d1jgom_ i.1.1.1 (M:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1jgom_:

• d1jgom_ first appeared in SCOP 1.57
  
• d1jgom_ appears in SCOPe 2.03
  
• d1jgom_ appears in SCOPe 2.05
  
• d1jgom_ appears in the current release, SCOPe 2.08