Lineage for d1jg8a_ (1jg8 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) 
Family c.67.1.1: AAT-like [53384] (5 proteins) 
Protein Low-specificity threonine aldolase [64123] (1 species) Species Thermatoga maritima [64124] (1 PDB entry) 
Domain d1jg8a_: 1jg8 A: [62946]
Details for d1jg8a_
PDB Entry: 1jg8 (more details), 1.8 Å
PDB Description: crystal structure of threonine aldolase (low-specificity)
SCOP Domain Sequences for d1jg8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jg8a_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermatoga maritima}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
SCOP Domain Coordinates for d1jg8a_:
Click to download the PDB-style file with coordinates for d1jg8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jg8a_:
- d1jg8a_ is new in SCOP 1.57
- d1jg8a_ appears in SCOP 1.59
- d1jg8a_ appears in the current release, SCOPe 2.08
View in 3D
