Lineage for d1jfxa_ (1jfx A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (1 protein) Protein Streptomyces lysozyme [63913] (1 species) Species Streptomyces coelicolor, "mueller" dsm3030 [TaxId:1902] [63914] (1 PDB entry) 
Domain d1jfxa_: 1jfx A: [62943]
Details for d1jfxa_
PDB Entry: 1jfx (more details), 1.65 Å
PDB Description: Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution
SCOP Domain Sequences for d1jfxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfxa_ c.1.8.8 (A:) Streptomyces lysozyme {Streptomyces coelicolor, "mueller" dsm3030}
dtsgvqgidvshwqgsinwssvksagmsfayikategtnykddrfsanytnaynagiirg
ayhfarpnassgtaqadyfasngggwsrdnrtlpgvldiehnpsgamcyglsttqmrtwi
ndfharykarttrdvviyttaswwntctgswngmaakspfwvahwgvsaptvpsgfptwt
fwqysatgrvggvsgdvdrnkfngsaarllalannta
SCOP Domain Coordinates for d1jfxa_:
Click to download the PDB-style file with coordinates for d1jfxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfxa_:
- d1jfxa_ is new in SCOP 1.57
- d1jfxa_ appears in SCOP 1.59
- d1jfxa_ appears in the current release, SCOPe 2.08
View in 3D