SCOPe 2.07: Domain d1jfic2: 1jfi C:457-538

Lineage for d1jfic2 (1jfi C:457-538)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)

8. Domain d1jfic2: 1jfi C:457-538 [62939]
   Other proteins in same PDB: d1jfia_, d1jfib_, d1jfic3
   protein/DNA complex

Details for d1jfic2

PDB Entry: 1jfi, 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex

PDB Compounds: (C:) tata-box-binding protein (tbp)

SCOPe Domain Sequences for d1jfic2:

Sequence; same for both SEQRES and ATOM records:

>d1jfic2 d.129.1.1 (C:457-538) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvltgak
vraeiyeafeniypilkgfrkt

Timeline for d1jfic2:

• d1jfic2 first appeared in SCOP 1.57
  
• d1jfic2 appears in SCOPe 2.06
  
• d1jfic2 appears in the current release, SCOPe 2.08