Lineage for d1jf9a_ (1jf9 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705666Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 705830Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 705831Species Escherichia coli [TaxId:562] [53414] (5 PDB entries)
    gene product CsdB
  8. 705832Domain d1jf9a_: 1jf9 A: [62931]
    complexed with plp

Details for d1jf9a_

PDB Entry: 1jf9 (more details), 2 Å

PDB Description: crystal structure of selenocysteine lyase
PDB Compounds: (A:) selenocysteine lyase

SCOP Domain Sequences for d1jf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOP Domain Coordinates for d1jf9a_:

Click to download the PDB-style file with coordinates for d1jf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf9a_: