Lineage for d1jf9a_ (1jf9 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73298Family c.67.1.3: Cystathionine synthase-like [53402] (7 proteins)
  6. 73393Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 73394Species Escherichia coli [TaxId:562] [53414] (2 PDB entries)
  8. 73395Domain d1jf9a_: 1jf9 A: [62931]

Details for d1jf9a_

PDB Entry: 1jf9 (more details), 2 Å

PDB Description: crystal structure of selenocysteine lyase

SCOP Domain Sequences for d1jf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOP Domain Coordinates for d1jf9a_:

Click to download the PDB-style file with coordinates for d1jf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf9a_: