SCOP 1.67: Domain d1jf1a1: 1jf1 A:182-275

Lineage for d1jf1a1 (1jf1 A:182-275)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)

8. Domain d1jf1a1: 1jf1 A:182-275 [62927]
   Other proteins in same PDB: d1jf1a2, d1jf1b_
   complexed with zn; mutant

Details for d1jf1a1

PDB Entry: 1jf1, 1.85 Å

PDB Description: Crystal structure of HLA-A2*0201 in complex with a decameric altered peptide ligand from the MART-1/Melan-A

SCOP Domain Sequences for d1jf1a1:

Sequence, based on SEQRES records:

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqttelvetrpagdgtfqk
waavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1jf1a1:

• d1jf1a1 first appeared in SCOP 1.57
  
• d1jf1a1 appears in SCOP 1.65
  
• d1jf1a1 appears in SCOP 1.69
  
• d1jf1a1 appears in the current release, SCOPe 2.08