![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (18 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcium-regulated photoprotein [47512] (3 species) structurally most similar to sarcoplasmic calcium-binding protein |
![]() | Species Hydrozoa (Obelia geniculata), obelin [TaxId:185004] [63542] (1 PDB entry) |
![]() | Domain d1jf0a_: 1jf0 A: [62926] complexed with czh |
PDB Entry: 1jf0 (more details), 1.82 Å
SCOP Domain Sequences for d1jf0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia geniculata), obelin} kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld peadglygngvp
Timeline for d1jf0a_: