Lineage for d1jf0a_ (1jf0 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152578Family a.39.1.5: Calmodulin-like [47502] (16 proteins)
  6. 152594Protein Calcium-regulated photoprotein [47512] (3 species)
  7. 152595Species Hydrozoa (Obelia geniculata), obelin [TaxId:185004] [63542] (1 PDB entry)
  8. 152596Domain d1jf0a_: 1jf0 A: [62926]

Details for d1jf0a_

PDB Entry: 1jf0 (more details), 1.82 Å

PDB Description: the crystal structure of obelin from obelia geniculata at 1.82 a resolution

SCOP Domain Sequences for d1jf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia geniculata), obelin}
kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr
hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd
kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld
peadglygngvp

SCOP Domain Coordinates for d1jf0a_:

Click to download the PDB-style file with coordinates for d1jf0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf0a_: