Lineage for d1jeyb_ (1jey B:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339985Fold e.31: Ku heterodimer subunits [64500] (1 superfamily)
    3 domains: (1) integrin A-like alpha/beta; (2) beta-barrel (n=7, s=10); (3) helical arm with an HTH motif
  4. 339986Superfamily e.31.1: Ku heterodimer subunits [64501] (2 families) (S)
  5. 339992Family e.31.1.2: Ku80 subunit [64505] (1 protein)
  6. 339993Protein Ku80 subunit [64506] (1 species)
  7. 339994Species Human (Homo sapiens) [TaxId:9606] [64507] (2 PDB entries)
  8. 339995Domain d1jeyb_: 1jey B: [62925]
    Other proteins in same PDB: d1jeya_

Details for d1jeyb_

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna

SCOP Domain Sequences for d1jeyb_:

Sequence, based on SEQRES records: (download)

>d1jeyb_ e.31.1.2 (B:) Ku80 subunit {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgdgpfrl
gghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsi
hwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetev
lkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvf
aarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlp
fmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnp
rfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplieakkk

Sequence, based on observed residues (ATOM records): (download)

>d1jeyb_ e.31.1.2 (B:) Ku80 subunit {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslggpfrlgghgpsfplk
giteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigs
nlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfr
ygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaav
alsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymf
sslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcll
hralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplieakkk

SCOP Domain Coordinates for d1jeyb_:

Click to download the PDB-style file with coordinates for d1jeyb_.
(The format of our PDB-style files is described here.)

Timeline for d1jeyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jeya_