Lineage for d1jeya_ (1jey A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339985Fold e.31: Ku heterodimer subunits [64500] (1 superfamily)
    3 domains: (1) integrin A-like alpha/beta; (2) beta-barrel (n=7, s=10); (3) helical arm with an HTH motif
  4. 339986Superfamily e.31.1: Ku heterodimer subunits [64501] (2 families) (S)
  5. 339987Family e.31.1.1: Ku70 subunit [64502] (1 protein)
  6. 339988Protein Ku70 subunit [68905] (1 species)
  7. 339989Species Human (Homo sapiens) [TaxId:9606] [64504] (2 PDB entries)
  8. 339990Domain d1jeya_: 1jey A: [62924]
    Other proteins in same PDB: d1jeyb_

Details for d1jeya_

PDB Entry: 1jey (more details), 2.5 Å

PDB Description: crystal structure of the ku heterodimer bound to dna

SCOP Domain Sequences for d1jeya_:

Sequence, based on SEQRES records: (download)

>d1jeya_ e.31.1.1 (A:) Ku70 subunit {Human (Homo sapiens)}
grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
slfyrdiisiaededlrvhfeesskledllrkvraketrkralsrlklklnkdivisvgi
ynlvqkalkpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekee
teelkrfddpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikcleke
vaalcrytprrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekim
atpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkvea
mnkrlgslvdefkelvyppdy

Sequence, based on observed residues (ATOM records): (download)

>d1jeya_ e.31.1.1 (A:) Ku70 subunit {Human (Homo sapiens)}
grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
slfyrdiisvhfeesskledllrkvraketrkralsrlklklnkdivisvgiynlvqkal
kpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfd
dpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekevaalcryt
prrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgk
mkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgsl
vdefkelvyppdy

SCOP Domain Coordinates for d1jeya_:

Click to download the PDB-style file with coordinates for d1jeya_.
(The format of our PDB-style files is described here.)

Timeline for d1jeya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jeyb_