Lineage for d1jeqb_ (1jeq B:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87510Fold e.31: Ku heterodimer subunits [64500] (1 superfamily)
  4. 87511Superfamily e.31.1: Ku heterodimer subunits [64501] (2 families) (S)
  5. 87517Family e.31.1.2: Ku70 subunit [64505] (1 protein)
  6. 87518Protein Ku70 subunit [64506] (1 species)
  7. 87519Species Human (Homo sapiens) [TaxId:9606] [64507] (2 PDB entries)
  8. 87521Domain d1jeqb_: 1jeq B: [62922]
    Other proteins in same PDB: d1jeqa_

Details for d1jeqb_

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: crystal structure of the ku heterodimer

SCOP Domain Sequences for d1jeqb_:

Sequence, based on SEQRES records: (download)

>d1jeqb_ e.31.1.2 (B:) Ku70 subunit {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgdgpfrl
gghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsi
hwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetev
lkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvf
aarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlp
fmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnp
rfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpliea

Sequence, based on observed residues (ATOM records): (download)

>d1jeqb_ e.31.1.2 (B:) Ku70 subunit {Human (Homo sapiens)}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslpfrlgghgfplkgite
qqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigsnlsi
riaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfrygsd
ivpfdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaavalsslih
alddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymfsslknsk
kyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcllhralhpr
eplppiqqhiwnmlnppaevttksqiplskiktlfpliea

SCOP Domain Coordinates for d1jeqb_:

Click to download the PDB-style file with coordinates for d1jeqb_.
(The format of our PDB-style files is described here.)

Timeline for d1jeqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jeqa_