SCOP 1.65: Domain d1jek.1: 1jek A:,B:

Lineage for d1jek.1 (1jek A:,B:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Visna virus [TaxId:11741] [64597] (1 PDB entry)

8. Domain d1jek.1: 1jek A:,B: [62920]

Details for d1jek.1

PDB Entry: 1jek, 1.5 Å

PDB Description: visna tm core structure

SCOP Domain Sequences for d1jek.1:

Sequence; same for both SEQRES and ATOM records:

>g1jek.1 h.3.2.1 (A:,B:) Retrovius gp41 protease-resistant core {Visna virus}
qslanataaqqevleasyamvqhiakgirilearvarveaXwqqweeeieqhegnlslll
reaalqvhiaqrdar

Timeline for d1jek.1:

• d1jek.1 first appeared in SCOP 1.57
  
• d1jek.1 appears in SCOP 1.63
  
• d1jek.1 appears in SCOP 1.67
  
• d1jek.1 appears in the current release, SCOPe 2.08