Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
Protein gp2.5 [63774] (1 species) |
Species Bacteriophage T7 [TaxId:10760] [63775] (1 PDB entry) |
Domain d1je5b_: 1je5 B: [62910] complexed with ca |
PDB Entry: 1je5 (more details), 1.9 Å
SCOPe Domain Sequences for d1je5b_:
Sequence, based on SEQRES records: (download)
>d1je5b_ b.40.4.7 (B:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} akkiftsalgtaepyayiakpdygneergfgnprgvykvdltipnkdprcqrmvdeivkc heeayaaaveeyeanppavargkkplkpyegdmpffdngdgtttfkfkcyasfqdkktke tkhinlvvvdskgkkmedvpiigggsklkvkyslvpykwntavgasvklqlesvmlvela tfgggeddwadeveengyvas
>d1je5b_ b.40.4.7 (B:) gp2.5 {Bacteriophage T7 [TaxId: 10760]} akkiftsalgtaepyayiakpdyprgvykvdltipnkdprcqrmvdeivkcheeayaaav eeyeanpppyegdmpffdngdgtttfkfkcyasfqdkktketkhinlvvvdskgkkmedv piigggsklkvkyslvpykwntavgasvklqlesvmlvelatfgggeddwadeveengyv as
Timeline for d1je5b_: