Lineage for d1je5b_ (1je5 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125476Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 1125509Protein gp2.5 [63774] (1 species)
  7. 1125510Species Bacteriophage T7 [TaxId:10760] [63775] (1 PDB entry)
  8. 1125512Domain d1je5b_: 1je5 B: [62910]
    complexed with ca

Details for d1je5b_

PDB Entry: 1je5 (more details), 1.9 Å

PDB Description: Crystal Structure of gp2.5, a Single-Stranded DNA Binding Protein Encoded by Bacteriophage T7
PDB Compounds: (B:) helix-destabilizing protein

SCOPe Domain Sequences for d1je5b_:

Sequence, based on SEQRES records: (download)

>d1je5b_ b.40.4.7 (B:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}
akkiftsalgtaepyayiakpdygneergfgnprgvykvdltipnkdprcqrmvdeivkc
heeayaaaveeyeanppavargkkplkpyegdmpffdngdgtttfkfkcyasfqdkktke
tkhinlvvvdskgkkmedvpiigggsklkvkyslvpykwntavgasvklqlesvmlvela
tfgggeddwadeveengyvas

Sequence, based on observed residues (ATOM records): (download)

>d1je5b_ b.40.4.7 (B:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}
akkiftsalgtaepyayiakpdyprgvykvdltipnkdprcqrmvdeivkcheeayaaav
eeyeanpppyegdmpffdngdgtttfkfkcyasfqdkktketkhinlvvvdskgkkmedv
piigggsklkvkyslvpykwntavgasvklqlesvmlvelatfgggeddwadeveengyv
as

SCOPe Domain Coordinates for d1je5b_:

Click to download the PDB-style file with coordinates for d1je5b_.
(The format of our PDB-style files is described here.)

Timeline for d1je5b_: