Lineage for d1jcfa1 (1jcf A:1-140)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586266Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 586435Protein Prokaryotic actin homolog MreB [64087] (1 species)
  7. 586436Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries)
  8. 586439Domain d1jcfa1: 1jcf A:1-140 [62878]

Details for d1jcfa1

PDB Entry: 1jcf (more details), 2.1 Å

PDB Description: mreb from thermotoga maritima, trigonal

SCOP Domain Sequences for d1jcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcfa1 c.55.1.1 (A:1-140) Prokaryotic actin homolog MreB {Thermotoga maritima}
mlrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatik
airpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagle
agaskvflieepmaaaigsn

SCOP Domain Coordinates for d1jcfa1:

Click to download the PDB-style file with coordinates for d1jcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1jcfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcfa2