SCOP 1.69: Domain d1jcfa1: 1jcf A:1-140

Lineage for d1jcfa1 (1jcf A:1-140)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Prokaryotic actin homolog MreB [64087] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries)

8. Domain d1jcfa1: 1jcf A:1-140 [62878]

Details for d1jcfa1

PDB Entry: 1jcf, 2.1 Å

PDB Description: mreb from thermotoga maritima, trigonal

SCOP Domain Sequences for d1jcfa1:

Sequence; same for both SEQRES and ATOM records:

>d1jcfa1 c.55.1.1 (A:1-140) Prokaryotic actin homolog MreB {Thermotoga maritima}
mlrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatik
airpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagle
agaskvflieepmaaaigsn

Timeline for d1jcfa1:

• d1jcfa1 first appeared in SCOP 1.57
  
• d1jcfa1 appears in SCOP 1.67
  
• d1jcfa1 appears in SCOP 1.71
  
• d1jcfa1 appears in the current release, SCOPe 2.08