Lineage for d1jbpe_ (1jbp E:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins) 
Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) Species Mouse (Mus musculus) [TaxId:10090] [56119] (8 PDB entries) 
Domain d1jbpe_: 1jbp E: [62849]
Details for d1jbpe_
PDB Entry: 1jbp (more details), 2.2 Å
PDB Description: crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a substrate peptide, adp and detergent
SCOP Domain Sequences for d1jbpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbpe_ d.144.1.1 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus)}
gseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnh
yamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggem
fshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfa
krvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadepiqiye
kivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqr
kveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
SCOP Domain Coordinates for d1jbpe_:
Click to download the PDB-style file with coordinates for d1jbpe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jbpe_:
- d1jbpe_ first appeared in SCOP 1.57
- d1jbpe_ appears in SCOP 1.61
- d1jbpe_ appears in the current release, SCOPe 2.08
View in 3D