Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (2 PDB entries) |
Domain d1jbba_: 1jbb A: [62842] |
PDB Entry: 1jbb (more details), 2 Å
SCOP Domain Sequences for d1jbba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbba_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla ndvaedwikneqgakakarewtklyakk
Timeline for d1jbba_: