SCOPe 2.03: Domain d1jb9a1: 1jb9 A:6-162

Lineage for d1jb9a1 (1jb9 A:6-162)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Maize (Zea mays), root isoform [TaxId:4577] [63786] (1 PDB entry)

8. Domain d1jb9a1: 1jb9 A:6-162 [62840]
   Other proteins in same PDB: d1jb9a2
   complexed with fad

Details for d1jb9a1

PDB Entry: 1jb9, 1.7 Å

PDB Description: crystal structure of the ferredoxin:nadp+ reductase from maize root at 1.7 angstroms

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1jb9a1:

Sequence; same for both SEQRES and ATOM records:

>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]}
srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
edpskngvcsnflcnskpgdkiqltgpsgkimllpee

Timeline for d1jb9a1:

• d1jb9a1 first appeared in SCOP 1.57
  
• d1jb9a1 appears in SCOPe 2.02
  
• d1jb9a1 appears in SCOPe 2.04
  
• d1jb9a1 appears in the current release, SCOPe 2.08