Lineage for d1jb9a1 (1jb9 A:6-162)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111451Species Maize (Zea mays), root isoform [TaxId:4577] [63786] (1 PDB entry)
  8. 111452Domain d1jb9a1: 1jb9 A:6-162 [62840]
    Other proteins in same PDB: d1jb9a2

Details for d1jb9a1

PDB Entry: 1jb9 (more details), 1.7 Å

PDB Description: crystal structure of the ferredoxin:nadp+ reductase from maize root at 1.7 angstroms

SCOP Domain Sequences for d1jb9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform}
srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
edpskngvcsnflcnskpgdkiqltgpsgkimllpee

SCOP Domain Coordinates for d1jb9a1:

Click to download the PDB-style file with coordinates for d1jb9a1.
(The format of our PDB-style files is described here.)

Timeline for d1jb9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jb9a2