Lineage for d1jb0d_ (1jb0 D:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265379Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 265380Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
  5. 265381Family d.187.1.1: Photosystem I subunit PsaD [64235] (1 protein)
  6. 265382Protein Photosystem I subunit PsaD [64236] (1 species)
  7. 265383Species Synechococcus elongatus [TaxId:32046] [64237] (1 PDB entry)
  8. 265384Domain d1jb0d_: 1jb0 D: [62823]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cl1, cl2, fs4, lhg, lmg, pqn

Details for d1jb0d_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria

SCOP Domain Sequences for d1jb0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0d_ d.187.1.1 (D:) Photosystem I subunit PsaD {Synechococcus elongatus}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

SCOP Domain Coordinates for d1jb0d_:

Click to download the PDB-style file with coordinates for d1jb0d_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0d_: