Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein Photosystem I iron-sulfur protein PsaC [64272] (4 species) |
Species Synechococcus elongatus [TaxId:32046] [64273] (1 PDB entry) |
Domain d1jb0c_: 1jb0 C: [62822] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x1, d1jb0x2 complexed with bcr, ca, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOPe Domain Sequences for d1jb0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} ahtvkiydtcigctqcvracptdvlemvpwdgckagqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d1jb0c_: