Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries) |
Domain d1jatb_: 1jat B: [62819] complexed with ubc13 |
PDB Entry: 1jat (more details), 1.6 Å
SCOPe Domain Sequences for d1jatb_:
Sequence, based on SEQRES records: (download)
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} skvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysls idcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkema tpankklrqpkegetf
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} skvprnfrlleelekgekescsygladsdditmtkwngtilgpphsnhenriyslsidcg pnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkematpan kklrqpkegetf
Timeline for d1jatb_: